PDB entry 1m61

View 1m61 on RCSB PDB site
Description: crystal structure of the apo sh2 domains of zap-70
Deposited on 2002-07-11, released 2003-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.245
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1m61a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m61A (A:)
    gshmpdpaahlpffygsisraeaeehlklagmadglfllrqclrslggyvlslvhdvrfh
    hfpierqlngtyaiaggkahcgpaelcefysrdpdglpcnlrkpcnrpsglepqpgvfdc
    lrdamvrdyvrqtwklegealeqaiisqapqvekliattahermpwyhssltreeaerkl
    ysgaqtdgkfllrprkeqgtyalsliygktvyhylisqdkagkycipegtkfdtlwqlve
    ylklkadgliyclkeacpn