PDB entry 1m5y

View 1m5y on RCSB PDB site
Description: Crystallographic Structure of SurA, a Molecular Chaperone that Facilitates Outer Membrane Porin Folding
Class: isomerase, cell cycle
Keywords: Survival protein A, periplasmic molecular chaperone, membrane protein folding, gram negative bacteria, crystal structure
Deposited on 2002-07-10, released 2002-11-08
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.228
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Survival protein surA
    Species: Escherichia coli
    Gene: sura
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1m5ya1, d1m5ya2, d1m5ya3
  • Chain 'B':
    Compound: Survival protein surA
    Species: Escherichia coli
    Gene: sura
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1m5yb1, d1m5yb2, d1m5yb3
  • Chain 'C':
    Compound: Survival protein surA
    Species: Escherichia coli
    Gene: sura
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1m5yc1, d1m5yc2, d1m5yc3
  • Chain 'D':
    Compound: Survival protein surA
    Species: Escherichia coli
    Gene: sura
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1m5yd1, d1m5yd2, d1m5yd3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m5yA (A:)
    apqvvdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqii
    lqmgqkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiise
    vrnnevrrritilpqeveslaqqvgnqndastelnlshiliplpenptsdqvneaesqar
    aivdqarngadfgklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpir
    sgvgfhilkvndlrgesknisvtevharhillkpspimtdeqarvkleqiaadiksgktt
    faaaakefsqdpgsanqggdlgwatpdifdpafrdaltrlnkgqmsapvhssfgwhliel
    ldtrnvdktdaaqkdrayrmlmnrkfseeaaswmqeqrasayvkilsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m5yA (A:)
    vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
    qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
    evrrritilpqeveslaqqvtelnlshiliplpenptsdqvneaesqaraivdqarngad
    fgklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpirsgvgfhilkvn
    dlrgesknisvtevharhillkpspimtdeqarvkleqiaadiksgkttfaaaakefsqd
    pgsanqggdlgwatpdifdpafrdaltrlnkgqmsapvhssfgwhlielldtrnvdrayr
    mlmnrkfseeaaswmqeqrasayvkils
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m5yB (B:)
    apqvvdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqii
    lqmgqkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiise
    vrnnevrrritilpqeveslaqqvgnqndastelnlshiliplpenptsdqvneaesqar
    aivdqarngadfgklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpir
    sgvgfhilkvndlrgesknisvtevharhillkpspimtdeqarvkleqiaadiksgktt
    faaaakefsqdpgsanqggdlgwatpdifdpafrdaltrlnkgqmsapvhssfgwhliel
    ldtrnvdktdaaqkdrayrmlmnrkfseeaaswmqeqrasayvkilsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m5yB (B:)
    vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
    qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
    evrrritilpqeveslaqqtelnlshiliplpenptsdqvneaesqaraivdqarngadf
    gklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpirsgvgfhilkvnd
    lrtevharhillkpspimtdeqarvkleqiaadiksgkttfaaaakefsqdpgsanqggd
    lgwatpdifdpafrdaltrlnkgqmsapvhssfgwhlielldtrnrayrmlmnrkfseea
    aswmqeqrasayvkils
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m5yC (C:)
    apqvvdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqii
    lqmgqkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiise
    vrnnevrrritilpqeveslaqqvgnqndastelnlshiliplpenptsdqvneaesqar
    aivdqarngadfgklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpir
    sgvgfhilkvndlrgesknisvtevharhillkpspimtdeqarvkleqiaadiksgktt
    faaaakefsqdpgsanqggdlgwatpdifdpafrdaltrlnkgqmsapvhssfgwhliel
    ldtrnvdktdaaqkdrayrmlmnrkfseeaaswmqeqrasayvkilsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m5yC (C:)
    vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
    qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
    evrrritilpqeveslaqqtelnlshiliplpenptsdqvneaesqaraivdqarngadf
    gklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpirsgvgfhilkvnd
    ltevharhillkpspimtdeqarvkleqiaadiksgkttfaaaakefsqdpgsanqggdl
    gwatpdifdpafrdaltrlnkgqmsapvhssfgwhlielldtrnrayrmlmnrkfseeaa
    swmqeqrasayvkils
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1m5yD (D:)
    apqvvdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqii
    lqmgqkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiise
    vrnnevrrritilpqeveslaqqvgnqndastelnlshiliplpenptsdqvneaesqar
    aivdqarngadfgklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpir
    sgvgfhilkvndlrgesknisvtevharhillkpspimtdeqarvkleqiaadiksgktt
    faaaakefsqdpgsanqggdlgwatpdifdpafrdaltrlnkgqmsapvhssfgwhliel
    ldtrnvdktdaaqkdrayrmlmnrkfseeaaswmqeqrasayvkilsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m5yD (D:)
    vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
    qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
    evrrritilpqeveslaqqtelnlshiliplpenptsdqvneaesqaraivdqarngadf
    gklaiahsadqqalnggqmgwgriqelpgifaqalstakkgdivgpirsgvgfhilkvnd
    lrgesknisvtevharhillkpspimtdeqarvkleqiaadiksgkttfaaaakefsqdp
    gsanqggdlgwatpdifdpafrdaltrlnkgqmsapvhssfgwhlielldtrnvdkrayr
    mlmnrkfseeaaswmqeqrasayvkilsn