PDB entry 1m5p

View 1m5p on RCSB PDB site
Description: transition state stabilization by a catalytic rna
Deposited on 2002-07-09, released 2002-10-12
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-22, with a file datestamp of 2002-11-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.63: d1m5pc_
  • Chain 'F':
    Domains in SCOP 1.63: d1m5pf_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5pC (C:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5pF (F:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakm