PDB entry 1m5o

View 1m5o on RCSB PDB site
Description: Transition State Stabilization by a Catalytic RNA
Deposited on 2002-07-09, released 2002-10-12
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-22, with a file datestamp of 2002-11-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.229
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.63: d1m5oc_
  • Chain 'F':
    Domains in SCOP 1.63: d1m5of_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5oC (C:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5oF (F:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiakmk