PDB entry 1m5n

View 1m5n on RCSB PDB site
Description: Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical NLS(67-94) of PTHrP
Deposited on 2002-07-09, released 2003-01-21
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-21, with a file datestamp of 2003-01-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Domains in SCOP 1.63: d1m5ns_

PDB Chain Sequences:

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5nS (S:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaa