PDB entry 1m5n

View 1m5n on RCSB PDB site
Description: Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical NLS(67-94) of PTHrP
Class: protein transport
Keywords: all helical protein, HEAT repeats, PROTEIN TRANSPORT
Deposited on 2002-07-09, released 2003-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'Q':
    Compound: parathyroid hormone-related protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: importin beta-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m5ns_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'Q':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5nS (S:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaa