PDB entry 1m5m

View 1m5m on RCSB PDB site
Description: crystal structure of cyanovirin-n complexed to oligomannose-9 (man-9)
Class: antiviral protein
Keywords: cyanovirin-n, hiv-inactivating, domain-swapping, gp120, hexamannoside, oligosaccharide, antiviral protein
Deposited on 2002-07-09, released 2002-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cyanovirin-N
  Species: Nostoc ellipsosporum [TaxId:45916]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81180 (0-100)
  Domains in SCOPe 2.08: d1m5ma_
• Chain 'B':
  Compound: Cyanovirin-N
  Species: Nostoc ellipsosporum [TaxId:45916]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81180 (0-100)
  Domains in SCOPe 2.08: d1m5mb_
• Heterogens: NHE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m5mA (A:)
  lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqpsnfietcrn
  tqlagsselaaecktraqqfvstkinlddhianidgtlkye
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m5mB (B:)
  lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqpsnfietcrn
  tqlagsselaaecktraqqfvstkinlddhianidgtlkye