PDB entry 1m5k

View 1m5k on RCSB PDB site
Description: Crystal structure of a hairpin ribozyme in the catalytically-active conformation
Class: translation/RNA
Keywords: hairpin ribozyme, catalytic RNA, u1a RNA binding protein docked conformation, substrate inhibitor strand, translation-RNA complex
Deposited on 2002-07-09, released 2002-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA inhibitor substrate
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: RNA hairpin ribozyme
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: protein (u1 small nuclear ribonucleoprotein a)
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.06: d1m5kc_
  • Chain 'D':
    Compound: RNA inhibitor substrate
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: RNA hairpin ribozyme
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: protein (u1 small nuclear ribonucleoprotein a)
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.06: d1m5kf_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m5kC (C:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m5kC (C:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1m5kF (F:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m5kF (F:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakm