PDB entry 1m5h

View 1m5h on RCSB PDB site
Description: Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus
Deposited on 2002-07-09, released 2002-07-26
The last revision prior to the SCOP 1.63 freeze date was dated 2002-07-26, with a file datestamp of 2002-07-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hA (A:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hB (B:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hC (C:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hD (D:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hE (E:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hF (F:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hG (G:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hH (H:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf