PDB entry 1m5h

View 1m5h on RCSB PDB site
Description: Formylmethanofuran:tetrahydromethanopterin formyltransferase from Archaeoglobus fulgidus
Class: transferase
Keywords: ALPHA/BETA SANDWICH, transferase
Deposited on 2002-07-09, released 2002-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28076
      • conflict (114)
      • conflict (128)
      • conflict (238)
    Domains in SCOPe 2.08: d1m5ha1, d1m5ha2
  • Chain 'B':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28076
      • conflict (114)
      • conflict (128)
      • conflict (238)
    Domains in SCOPe 2.08: d1m5hb1, d1m5hb2
  • Chain 'C':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28076
      • conflict (114)
      • conflict (128)
      • conflict (238)
    Domains in SCOPe 2.08: d1m5hc1, d1m5hc2
  • Chain 'D':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28076
      • conflict (114)
      • conflict (128)
      • conflict (238)
    Domains in SCOPe 2.08: d1m5hd1, d1m5hd2
  • Chain 'E':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28076
      • conflict (114)
      • conflict (128)
      • conflict (238)
    Domains in SCOPe 2.08: d1m5he1, d1m5he2
  • Chain 'F':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28076
      • conflict (114)
      • conflict (128)
      • conflict (238)
    Domains in SCOPe 2.08: d1m5hf1, d1m5hf2
  • Chain 'G':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28076
      • conflict (114)
      • conflict (128)
      • conflict (238)
    Domains in SCOPe 2.08: d1m5hg1, d1m5hg2
  • Chain 'H':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28076 (0-296)
      • conflict (114)
      • conflict (128)
      • conflict (238)
    Domains in SCOPe 2.08: d1m5hh1, d1m5hh2
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hA (A:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hB (B:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hC (C:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hD (D:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hE (E:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hF (F:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hG (G:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m5hH (H:)
    mkvngveveetfaeafdikiarvlitgydyywawvaaneatgfgtsvimcpaeagieika
    kpsetpdgrpgyyiqichmskkgleeqllarlgqcvltapttavfnglpdaeekddtgfk
    lkffadgyqkevevggrkcwavpmmegdfiiendigytngiaggnffimaetqpsalaaa
    kaavdaisdvegvitpfpggivasgskvgankykflkastnekfapsirdqvegtqipag
    vkavyeivinglnadaikeatrvgilaatkipgvvkitagnyggklgkhiinlnelf