PDB entry 1m59

View 1m59 on RCSB PDB site
Description: Crystal Structure of P40V Mutant of Trypsin-solubilized Fragment of Cytochrome b5
Class: electron transport
Keywords: cytochrome b5, P40V mutant, crystal structure, ELECTRON TRANSPORT
Deposited on 2002-07-09, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (37)
    Domains in SCOPe 2.07: d1m59a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m59A (A:)
avkyytleeiqkhnnskstwlilhykvydltkfleehvggeevlreqaggdatenfedvg
hstdarelsktfiigelhpddr