PDB entry 1m59

View 1m59 on RCSB PDB site
Description: crystal structure of p40v mutant of trypsin-solubilized fragment of cytochrome b5
Deposited on 2002-07-09, released 2003-03-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1m59a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m59A (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehvggeevlreqaggdatenfedvg
  hstdarelsktfiigelhpddr