PDB entry 1m58

View 1m58 on RCSB PDB site
Description: Solution Structure of Cytotoxic RC-RNase2
Class: hydrolase
Keywords: bullfrog, cytotoxicity, ribonuclease, NMR, HYDROLASE
Deposited on 2002-07-09, released 2003-01-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RC-RNase2 ribonuclease
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DFY8 (1-105)
      • initiating met (0)
    Domains in SCOPe 2.04: d1m58a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m58A (A:)
    mqnwetfqkkhltdtrdvkcdaemkkalfdckqkntfiyarpgrvqalckniivsknvls
    tdefylsdcnriklpchyklkkssnticitcenklpvhfvaveecp