PDB entry 1m4z

View 1m4z on RCSB PDB site
Description: Crystal structure of the N-terminal BAH domain of Orc1p
Class: gene regulation
Keywords: DNA replication, transcriptional silencing, chromatin, BAH domain, GENE REGULATION
Deposited on 2002-07-05, released 2002-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Origin recognition complex subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Orc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54784 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d1m4za1, d1m4za2
  • Chain 'B':
    Compound: Origin recognition complex subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Orc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54784 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d1m4zb1, d1m4zb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m4zA (A:)
    amtmaktlkdlqgweiittdeqgniidggqkrlrrrgaktehylkrssdgiklgrgdsvv
    mhneaagtysvymiqelrlntlnnvvelwaltylrwfevnplahyrqfnpdanilnrpln
    yynklfsetanknelyltaelaelqlfnfirvanvmdgskwevlkgnvdperdftvryic
    eptgekfvdiniedvkayikkvepreaqeylkdltlpskkkeikrgpqkkdkatqtaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4zA (A:)
    amtmaktlkdlqgweiittdeqgnitehylkrssdgiklgrgdsvvmhneaagtysvymi
    qelrlntlnnvvelwaltylrwfevnplahyrqfnpdanilnrplnyynklfsetankne
    lyltaelaelqlfnfirvanvmdgskwevlkgnvdperdftvryiceptgekfvdinied
    vkayikkvepreaqeylkdltlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m4zB (B:)
    amtmaktlkdlqgweiittdeqgniidggqkrlrrrgaktehylkrssdgiklgrgdsvv
    mhneaagtysvymiqelrlntlnnvvelwaltylrwfevnplahyrqfnpdanilnrpln
    yynklfsetanknelyltaelaelqlfnfirvanvmdgskwevlkgnvdperdftvryic
    eptgekfvdiniedvkayikkvepreaqeylkdltlpskkkeikrgpqkkdkatqtaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4zB (B:)
    mtmaktlkdlqgweiittdeqgnitehylkrssdgiklgrgdsvvmhneaagtysvymiq
    elrlntlnnvvelwaltylrwfevnplahyrqfnpdanilnrplnyynklfsetanknel
    yltaelaelqlfnfirvanvmdgskwevlkgnvdperdftvryiceptgekfvdiniedv
    kayikkvepreaqeylkdltlps