PDB entry 1m4y

View 1m4y on RCSB PDB site
Description: Crystal structure of HslV from Thermotoga maritima
Class: hydrolase
Keywords: N-terminal catalytic Threonine residue, HYDROLASE
Deposited on 2002-07-05, released 2003-05-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease hslv
    Species: Thermotoga maritima [TaxId:2336]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1m4ya_
  • Chain 'B':
    Compound: ATP-dependent protease hslv
    Species: Thermotoga maritima [TaxId:2336]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1m4yb_
  • Chain 'C':
    Compound: ATP-dependent protease hslv
    Species: Thermotoga maritima [TaxId:2336]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1m4yc_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m4yA (A:)
    ttilvvrrngqtvmggdgqvtfgstvlkgnarkvrklgegkvlagfagsvadamtlfdrf
    eaklrewggnltkaavelakdwrtdrvlrrlealllvadkenifiisgngeviqpdddaa
    aigsggpyalaaakallrntdlsareivekamtiageiciytnqnivieev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m4yB (B:)
    ttilvvrrngqtvmggdgqvtfgstvlkgnarkvrklgegkvlagfagsvadamtlfdrf
    eaklrewggnltkaavelakdwrtdrvlrrlealllvadkenifiisgngeviqpdddaa
    aigsggpyalaaakallrntdlsareivekamtiageiciytnqnivieev
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m4yC (C:)
    ttilvvrrngqtvmggdgqvtfgstvlkgnarkvrklgegkvlagfagsvadamtlfdrf
    eaklrewggnltkaavelakdwrtdrvlrrlealllvadkenifiisgngeviqpdddaa
    aigsggpyalaaakallrntdlsareivekamtiageiciytnqnivieev