PDB entry 1m4v

View 1m4v on RCSB PDB site
Description: Crystal structure of SET3, a superantigen-like protein from Staphylococcus aureus
Class: immune system
Keywords: OB-fold, Beta-grasp, superantigen fold, IMMUNE SYSTEM
Deposited on 2002-07-05, released 2002-07-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SET3, superantigen-like protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SET3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFS6 (Start-203)
      • see remark 999 (4)
      • see remark 999 (22)
      • see remark 999 (48-49)
      • see remark 999 (64)
      • see remark 999 (66)
      • see remark 999 (88)
      • see remark 999 (106)
      • see remark 999 (109)
      • see remark 999 (117)
      • see remark 999 (121-122)
      • see remark 999 (127)
      • see remark 999 (134)
      • see remark 999 (150)
      • see remark 999 (160)
      • see remark 999 (166)
      • see remark 999 (183-184)
      • see remark 999 (198)
    Domains in SCOPe 2.03: d1m4va1, d1m4va2
  • Chain 'B':
    Compound: SET3, superantigen-like protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SET3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFS6 (Start-203)
      • see remark 999 (4)
      • see remark 999 (22)
      • see remark 999 (48-49)
      • see remark 999 (64)
      • see remark 999 (66)
      • see remark 999 (88)
      • see remark 999 (106)
      • see remark 999 (109)
      • see remark 999 (117)
      • see remark 999 (121-122)
      • see remark 999 (127)
      • see remark 999 (134)
      • see remark 999 (150)
      • see remark 999 (160)
      • see remark 999 (166)
      • see remark 999 (183-184)
      • see remark 999 (198)
    Domains in SCOPe 2.03: d1m4vb1, d1m4vb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m4vA (A:)
    sehkakyenvtkdifdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgk
    dierlktrknpgldifvvkeaenrngtvfsyggvtkknqgayydylnapkfvikkevdag
    vythvkrhyiykeevslkeldfklrqyliqnfdlykkfpkdskikvimkdggyytfelnk
    klqphrmsdvidgrniekmeanir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4vA (A:)
    akyenvtkdifdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgkdier
    lktrknpgldifvvkeaetvfsyggvtkknqgayydylnapkfvikkevdagvythvkrh
    yiykeevslkeldfklrqyliqnfdlykkfpkdskikvimkdggyytfelnkklqphrms
    dvidgrniekmeanir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m4vB (B:)
    sehkakyenvtkdifdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgk
    dierlktrknpgldifvvkeaenrngtvfsyggvtkknqgayydylnapkfvikkevdag
    vythvkrhyiykeevslkeldfklrqyliqnfdlykkfpkdskikvimkdggyytfelnk
    klqphrmsdvidgrniekmeanir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4vB (B:)
    akyenvtkdifdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgkdier
    lktrknpgldifvvkeaentvfsyggvtkknqgayydylnapkfvikkevdagvythvkr
    hyiykeevslkeldfklrqyliqnfdlykkfpkdskikvimkdggyytfelnkklqphrm
    sdvidgrniekmeanir