PDB entry 1m4r

View 1m4r on RCSB PDB site
Description: crystal structure of recombinant human interleukin-22
Class: cytokine
Keywords: interleukin-22 (IL-22), interleukin-10 (IL-10), interferon-gamma, cytokines, CYTOKINE
Deposited on 2002-07-03, released 2003-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-22
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m4ra_
  • Chain 'B':
    Compound: Interleukin-22
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m4rb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m4rA (A:)
    qggaaapisshcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmser
    cylmkqvlnftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqkl
    kdtvkklgesgeikaigeldllfmslrnaci
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4rA (A:)
    shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
    ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
    sgeikaigeldllfmslrnaci
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m4rB (B:)
    qggaaapisshcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmser
    cylmkqvlnftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqkl
    kdtvkklgesgeikaigeldllfmslrnaci
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4rB (B:)
    hcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnf
    tleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklges
    geikaigeldllfmslrnaci