PDB entry 1m4q

View 1m4q on RCSB PDB site
Description: structure of the tsg101 uev domain in complex with a hiv-1 ptap "late domain" peptide, cns ensemble
Class: peptide binding protein
Keywords: Tsg101 UEV domain, virus budding, vacuolar protein sorting, late domain
Deposited on 2002-07-03, released 2002-11-06
The last revision prior to the SCOP 1.75 freeze date was dated 2002-11-06, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor susceptibility gene 101 protein
    Species: HOMO SAPIENS
    Gene: tumor susceptibility gene 101
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1m4qa_
  • Chain 'B':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1
    Gene: GAG
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1m4qA (A:)
mavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtip
vpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhp
qsdllgliqvmivvfgdeppvfsrp

    Sequence, based on observed residues (ATOM records): (download) 
    >1m4qA (A:)
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
sdllgliqvmivvfgdeppvfsrp

  • Chain 'B':
    No sequence available.