PDB entry 1m4p

View 1m4p on RCSB PDB site
Description: Structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP "late domain" peptide, DYANA Ensemble
Class: peptide binding protein
Keywords: Tsg101 UEV domain, virus budding, vacuolar protein sorting, late domain, PEPTIDE BINDING PROTEIN
Deposited on 2002-07-03, released 2002-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: tumor susceptibility gene 101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m4pa_
  • Chain 'B':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m4pA (A:)
    mavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtip
    vpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhp
    qsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4pA (A:)
    avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
    pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
    sdllgliqvmivvfgdeppvfsrp
    

  • Chain 'B':
    No sequence available.