PDB entry 1m4n

View 1m4n on RCSB PDB site
Description: crystal structure of apple acc synthase in complex with [2-(amino-oxy)ethyl](5'-deoxyadenosin-5'-yl)(methyl)sulfonium
Class: lyase
Keywords: Fruit ripening, Ethylene biosynthesis, Pyridoxal phosphate, LYASE
Deposited on 2002-07-03, released 2003-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate synthase
    Species: Malus x domestica [TaxId:3750]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m4na_
  • Heterogens: PLP, AAD, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m4nA (A:)
    mrmlsrnatfnshgqdssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswla
    knpeaaafkkngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltaga
    tsanetfifcladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetalee
    ayqeaekrnlrvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafss
    psfisvmevlkdrncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkms
    sfglvssqtqhllsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglf
    cwvdmrhllrsntfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldl
    amqrlkafvgeyynv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4nA (A:)
    lsrnatyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswlaknpeaaafkkng
    esifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltagatsanetfifcla
    dpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetaleeayqeaekrnlrv
    kgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafsspsfisvmevlkd
    rncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkmssfglvssqtqhl
    lsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglfcwvdmrhllrsn
    tfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldlamqrlkafvgey
    y