PDB entry 1m4k

View 1m4k on RCSB PDB site
Description:
Deposited on 2002-07-03, released 2003-04-15
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-15, with a file datestamp of 2003-04-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1m4ka1, d1m4ka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m4kA (A:)
    hegvhrkpsllahpgplvkseetvilqcwsdvrfehfllhregkykdtlhligehhdgvs
    kanfsigpmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvla
    gesvtlscssrssydmyhlsregeaherrfsagpkvngtfqadfplgpathggtyrcfgs
    frdspyewsnssdpllvsvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4kA (A:)
    psllahpgplvkseetvilqcwsdvrfehfllhregkykdtlhligehhdgvskanfsig
    pmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvlagesvtls
    cssrssydmyhlsregeaherrfsagpkvngtfqadfplgpathggtyrcfgsfrdspye
    wsnssdpllvsvt