PDB entry 1m4h

View 1m4h on RCSB PDB site
Description: Crystal Structure of Beta-secretase complexed with Inhibitor OM00-3
Class: hydrolase/hydrolase inhibitor
Keywords: memapsin2, base, asp2, alzheimer's disease, aspartic protease, acid protease, hydrolase-hydrolase inhibitor complex
Deposited on 2002-07-02, released 2002-08-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1m4ha_
  • Chain 'B':
    Compound: Beta-secretase
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1m4hb_
  • Chain 'C':
    Compound: Inhibitor OM00-3
    Database cross-references and differences (RAF-indexed):
    • PDB 1M4H (0-6)
  • Chain 'D':
    Compound: Inhibitor OM00-3
    Database cross-references and differences (RAF-indexed):
    • PDB 1M4H (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m4hA (A:)
    rrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqr
    qlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsn
    wegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsm
    iiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnl
    rlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnq
    sfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigf
    avsachvhdefrtaavegpfvtldmedcgyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m4hB (B:)
    rrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqr
    qlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsn
    wegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsm
    iiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnl
    rlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnq
    sfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigf
    avsachvhdefrtaavegpfvtldmedcgyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4hB (B:)
    gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
    sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
    gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
    ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
    pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
    ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
    sachvhdefrtaavegpfvtldmedcgyn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.