PDB entry 1m4d

View 1m4d on RCSB PDB site
Description: Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis-Complex with Coenzyme A and Tobramycin
Deposited on 2002-07-02, released 2002-08-28
The last revision prior to the SCOP 1.67 freeze date was dated 2002-08-28, with a file datestamp of 2002-08-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1m4da_
  • Chain 'B':
    Domains in SCOP 1.67: d1m4db_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m4dA (A:)
    mhtqvhtarlvhtadldsetrqdirqmvtgafagdftetdwehtlggmhaliwhhgaiia
    haaviqrrliyrgnalrcgyvegvavradwrgqrlvsalldaveqvmrgayqlgalsssa
    rarrlyasrgwlpwhgptsvlaptgpvrtpdddgtvfvlpidisldtsaelmcdwragdv
    w
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m4dB (B:)
    mhtqvhtarlvhtadldsetrqdirqmvtgafagdftetdwehtlggmhaliwhhgaiia
    haaviqrrliyrgnalrcgyvegvavradwrgqrlvsalldaveqvmrgayqlgalsssa
    rarrlyasrgwlpwhgptsvlaptgpvrtpdddgtvfvlpidisldtsaelmcdwragdv
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m4dB (B:)
    htarlvhtadldsetrqdirqmvtgafagdftetdwehtlggmhaliwhhgaiiahaavi
    qrrliyrgnalrcgyvegvavradwrgqrlvsalldaveqvmrgayqlgalsssararrl
    yasrgwlpwhgptsvlaptgpvrtpdddgtvfvlpidisldtsaelmcdwragdvw