PDB entry 1m4b

View 1m4b on RCSB PDB site
Description: Crystal Structure of Human Interleukin-2 K43C Covalently Modified at C43 with 2-[2-(2-Cyclohexyl-2-guanidino-acetylamino)-acetylamino]-N-(3-mercapto-propyl)-propionamide
Class: cytokine
Keywords: cytokine, four-helix bundle, small molecule complex
Deposited on 2002-07-02, released 2002-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60568 (Start-132)
      • engineered (42)
    Domains in SCOPe 2.08: d1m4ba_
  • Heterogens: NMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1m4bA (A:)
aptssstkktqlqlehllldlqmilnginnyknpkltrmltfcfympkkatelkhlqcle
eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
witfcqsiistlt

    Sequence, based on observed residues (ATOM records): (download) 
    >1m4bA (A:)
sstkktqlqlehllldlqmilnginnyknpkltrmltfcfympkkatelkhlqcleeelk
pleevlnlardlisninvivlelkgfmceyadetativeflnrwitfcqsiistlt