PDB entry 1m4a

View 1m4a on RCSB PDB site
Description: Crystal Structure of Human Interleukin-2 Y31C Covalently Modified at C31 with (1H-Indol-3-yl)-(2-mercapto-ethoxyimino)-acetic acid
Class: cytokine
Keywords: cytokine, four-helix bundle, small molecule complex
Deposited on 2002-07-02, released 2002-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.276
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60568
      • engineered (30)
    Domains in SCOPe 2.06: d1m4aa_
  • Heterogens: MPE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1m4aA (A:)
aptssstkktqlqlehllldlqmilnginncknpkltrmltfkfympkkatelkhlqcle
eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
witfcqsiistlt

    Sequence, based on observed residues (ATOM records): (download) 
    >1m4aA (A:)
tkktqlqlehllldlqmilnginncknpkltrmltfkfympkkatelkhlqcleeelkpl
eevlnlalrprdlisninvivlelfmceyadetativeflnrwitfcqsiistl