PDB entry 1m43

View 1m43 on RCSB PDB site
Description: crystal structure of pmii in complex with pepstatin a to 2.4 a
Deposited on 2002-07-02, released 2002-07-24
The last revision prior to the SCOP 1.65 freeze date was dated 2002-07-24, with a file datestamp of 2002-07-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1m43a_
  • Chain 'B':
    Domains in SCOP 1.65: d1m43b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m43A (A:)
    lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
    dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
    tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
    egpltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvik
    vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
    filgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m43B (B:)
    lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
    dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
    tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
    egpltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvik
    vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
    filgdpfmrkyftvfdydnhsvgialakknl