PDB entry 1m43

View 1m43 on RCSB PDB site
Description: Crystal structure of PMII in complex with pepstatin a to 2.4 A
Class: hydrolase/hydrolase inhibitor
Keywords: plasmepsin II, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2002-07-02, released 2002-07-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin II
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46925 (0-330)
      • engineered (206)
    Domains in SCOPe 2.06: d1m43a_
  • Chain 'B':
    Compound: plasmepsin II
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46925 (0-330)
      • engineered (206)
    Domains in SCOPe 2.06: d1m43b_
  • Chain 'C':
    Compound: pepstatin
    Database cross-references and differences (RAF-indexed):
    • PDB 1M43
  • Chain 'D':
    Compound: pepstatin
    Database cross-references and differences (RAF-indexed):
    • PDB 1M43 (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m43A (A:)
    lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
    dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
    tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
    egpltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvik
    vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
    filgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m43B (B:)
    lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
    dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
    tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
    egpltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvik
    vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
    filgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.