PDB entry 1m40

View 1m40 on RCSB PDB site
Description: ultra high resolution crystal structure of tem-1
Class: hydrolase
Keywords: beta-lactamase, acylation mechanism, x-ray structure, ultra-high resolution, hydrolase
Deposited on 2002-07-01, released 2002-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.85 Å
R-factor: 0.091
AEROSPACI score: 1.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (156)
    Domains in SCOPe 2.07: d1m40a_
  • Heterogens: PO4, K, CB4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m40A (A:)
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw