PDB entry 1m3y

View 1m3y on RCSB PDB site
Description: The Structure of Major Capsid protein of a large, lipid containing, DNA virus
Class: viral protein
Keywords: Major Capsit Protein Vp54, PBCV-1, Chlorella virus, Jelly roll motif, Glycoprotein, Viral protein
Deposited on 2002-07-01, released 2002-12-04
Made obsolete by 5tip on 2017-10-18

The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: The Major capsid protein of PBCV-1, Vp54
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m3ya1, d1m3ya2
  • Chain 'B':
    Compound: The Major capsid protein of PBCV-1, Vp54
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m3yb1, d1m3yb2
  • Chain 'C':
    Compound: The Major capsid protein of PBCV-1, Vp54
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m3yc1, d1m3yc2
  • Chain 'D':
    Compound: The Major capsid protein of PBCV-1, Vp54
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m3yd1, d1m3yd2
  • Heterogens: NDG, MAN, NAG, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3yA (A:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3yB (B:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3yC (C:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3yD (D:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan