PDB entry 1m3v

View 1m3v on RCSB PDB site
Description: FLIN4: Fusion of the LIM binding domain of Ldb1 and the N-terminal LIM domain of LMO4
Class: metal binding protein
Keywords: LIM domain, fusion protein, LMO proteins, Ldb1, METAL BINDING PROTEIN
Deposited on 2002-06-30, released 2003-05-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fusion of the LIM interacting domain of ldb1 and the N-terminal LIM domain of LMO4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70662 (0-70)
      • engineered (36)
      • engineered (48)
    • Uniprot P70662 (82-121)
    Domains in SCOPe 2.01: d1m3va1, d1m3va2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m3vA (A:)
gslswkrcagcggkiadrfllyamdsywhsrclkcsscqaqlgdigtssytksgmilcrn
dyirlfgnsgaggsgghmgsggdvmvvgeptlmggefgdederlitrlentqfdaangid
de