SCOPe 2.05: Structural Classification of Proteins

PDB entry 1m3u

View 1m3u on RCSB PDB site
Description: Crystal Structure of Ketopantoate Hydroxymethyltransferase complexed the Product Ketopantoate
Class: transferase
Keywords: beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionine MAD, decamer, TRANSFERASE
Deposited on 2002-06-30, released 2003-07-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.153
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Escherichia coli [TaxId:562]
Gene: PANB
Database cross-references and differences (RAF-indexed):
- Uniprot P31057 (Start-263)
Domains in SCOPe 2.05: d1m3ua_
Chain 'B':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Escherichia coli [TaxId:562]
Gene: PANB
Database cross-references and differences (RAF-indexed):
- Uniprot P31057 (Start-263)
Domains in SCOPe 2.05: d1m3ub_
Chain 'C':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Escherichia coli [TaxId:562]
Gene: PANB
Database cross-references and differences (RAF-indexed):
- Uniprot P31057 (Start-263)
Domains in SCOPe 2.05: d1m3uc_
Chain 'D':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Escherichia coli [TaxId:562]
Gene: PANB
Database cross-references and differences (RAF-indexed):
- Uniprot P31057 (Start-263)
Domains in SCOPe 2.05: d1m3ud_
Chain 'E':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Escherichia coli [TaxId:562]
Gene: PANB
Database cross-references and differences (RAF-indexed):
- Uniprot P31057 (Start-263)
Domains in SCOPe 2.05: d1m3ue_
Chain 'F':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Escherichia coli [TaxId:562]
Gene: PANB
Database cross-references and differences (RAF-indexed):
- Uniprot P31057 (Start-263)
Domains in SCOPe 2.05: d1m3uf_
Chain 'G':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Escherichia coli [TaxId:562]
Gene: PANB
Database cross-references and differences (RAF-indexed):
- Uniprot P31057 (Start-263)
Domains in SCOPe 2.05: d1m3ug_
Chain 'H':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Escherichia coli [TaxId:562]
Gene: PANB
Database cross-references and differences (RAF-indexed):
- Uniprot P31057 (Start-263)
Domains in SCOPe 2.05: d1m3uh_
Chain 'I':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Escherichia coli [TaxId:562]
Gene: PANB
Database cross-references and differences (RAF-indexed):
- Uniprot P31057 (Start-263)
Domains in SCOPe 2.05: d1m3ui_
Chain 'J':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Escherichia coli [TaxId:562]
Gene: PANB
Database cross-references and differences (RAF-indexed):
- Uniprot P31057 (Start-263)
Domains in SCOPe 2.05: d1m3uj_
Heterogens: MG, KPL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1m3uA (A:)
mkpttisllqkykqekkrfatitaydysfaklfadeglnvmlvgdslgmtvqghdstlpv
tvadiayhtaavrrgapncllladlpfmayatpeqafenaatvmraganmvkieggewlv
etvqmlteravpvcghlgltpqsvnifggykvqgrgdeagdqllsdalaleaagaqllvl
ecvpvelakritealaipvigigagnvtdgqilvmhdafgitgghipkfaknflaetgdi
raavrqymaevesgvypgeehsfh