PDB entry 1m3q

View 1m3q on RCSB PDB site
Description: Crystal Structure of hogg1 D268E Mutant with Base-Excised DNA and 8-aminoguanine
Class: hydrolase/DNA
Keywords: 8-oxoguanine, DNA glycosylase, DNA repair, end product, hogg, 8-aminoguanine, re-ligation, HYDROLASE/DNA COMPLEX
Deposited on 2002-06-28, released 2004-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.235
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-oxoguanine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (3-316)
      • cloning artifact (0-2)
      • engineered (259)
    Domains in SCOPe 2.06: d1m3qa1, d1m3qa2, d1m3qa3
  • Chain 'B':
    Compound: 5'-d(*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*cp*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*cp*gp*tp*cp*cp*ap*(drz)p*gp*tp*cp*tp*ap*cp*c)-3'
  • Heterogens: CA, ANG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m3qA (A:)
    gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
    gvrllrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqala
    gpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgt
    kvadciclmaldkpqavpvevhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwg
    pyagwaqavlfsadlrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m3qA (A:)
    gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkva
    dciclmaldkpqavpvevhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpya
    gwaqavlfsadlrq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.