PDB entry 1m3h

View 1m3h on RCSB PDB site
Description: Crystal Structure of Hogg1 D268E Mutant with Product Oligonucleotide
Class: hydrolase/DNA
Keywords: Protein-DNA complex, end product, DNA repair, DNA glycosylase, mutant, enzyme, HYDROLASE/DNA COMPLEX
Deposited on 2002-06-27, released 2004-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.239
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-oxoguanine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (3-316)
      • cloning artifact (0-2)
      • engineered (259)
    Domains in SCOPe 2.06: d1m3ha1, d1m3ha2, d1m3ha3
  • Chain 'B':
    Compound: 5'-d(p*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*cp*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(p*gp*cp*gp*tp*cp*cp*ap*(ddx))-3'
  • Chain 'D':
    Compound: 5'-d(p*gp*tp*cp*tp*ap*cp*c)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m3hA (A:)
    gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
    gvrllrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqala
    gpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgt
    kvadciclmaldkpqavpvevhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwg
    pyagwaqavlfsadlrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m3hA (A:)
    gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkva
    dciclmaldkpqavpvevhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpya
    gwaqavlfsadlrq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.