PDB entry 1m3g

View 1m3g on RCSB PDB site
Description: solution structure of the catalytic domain of mapk phosphatase pac-1: insights into substrate-induced enzymatic activation
Class: hydrolase
Keywords: catalytic domain, mapk phosphatase, pac-1, nmr
Deposited on 2002-06-27, released 2003-06-27
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-03, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dual specificity protein phosphatase 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05923 (0-144)
      • engineered (87)
    Domains in SCOP 1.73: d1m3ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3gA (A:)
    qggpveilpylflgscshssdlqglqacgitavlnvsascpnhfeglfryksipvednqm
    veisawfqeaigfidwvknsggrvlvhsqagisrsaticlaylmqsrrvrldeafdfvkq
    rrgvispnfsfmgqllqfetqvlch