PDB entry 1m3g

View 1m3g on RCSB PDB site
Description: solution structure of the catalytic domain of mapk phosphatase pac-1: insights into substrate-induced enzymatic activation
Deposited on 2002-06-27, released 2003-06-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1m3ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3gA (A:)
    qggpveilpylflgscshssdlqglqacgitavlnvsascpnhfeglfryksipvednqm
    veisawfqeaigfidwvknsggrvlvhsqagisrsaticlaylmqsrrvrldeafdfvkq
    rrgvispnfsfmgqllqfetqvlch