PDB entry 1m3e

View 1m3e on RCSB PDB site
Description: Succinyl-COA:3-ketoacid COA transferase from pig heart (selenomethionine)
Class: transferase
Keywords: alpha/beta protein, TRANSFERASE
Deposited on 2002-06-27, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinyl-coa:3-ketoacid-coenzyme a transferase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29551 (0-480)
      • modified residue (71)
      • modified residue (194)
      • modified residue (277)
      • modified residue (297)
      • modified residue (348)
      • modified residue (358)
      • modified residue (362)
      • modified residue (374)
      • modified residue (383)
      • modified residue (387)
      • modified residue (401)
      • modified residue (413)
      • modified residue (475)
    Domains in SCOPe 2.07: d1m3ea1, d1m3ea2
  • Chain 'B':
    Compound: succinyl-coa:3-ketoacid-coenzyme a transferase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29551 (0-480)
      • modified residue (71)
      • modified residue (194)
      • modified residue (277)
      • modified residue (297)
      • modified residue (348)
      • modified residue (358)
      • modified residue (362)
      • modified residue (374)
      • modified residue (383)
      • modified residue (387)
      • modified residue (401)
      • modified residue (413)
      • modified residue (475)
    Domains in SCOPe 2.07: d1m3eb1, d1m3eb2
  • Chain 'C':
    Compound: succinyl-coa:3-ketoacid-coenzyme a transferase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29551 (0-480)
      • modified residue (71)
      • modified residue (194)
      • modified residue (277)
      • modified residue (297)
      • modified residue (348)
      • modified residue (358)
      • modified residue (362)
      • modified residue (374)
      • modified residue (383)
      • modified residue (387)
      • modified residue (401)
      • modified residue (413)
      • modified residue (475)
    Domains in SCOPe 2.07: d1m3ec1, d1m3ec2
  • Chain 'D':
    Compound: succinyl-coa:3-ketoacid-coenzyme a transferase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29551 (0-480)
      • modified residue (71)
      • modified residue (194)
      • modified residue (277)
      • modified residue (297)
      • modified residue (348)
      • modified residue (358)
      • modified residue (362)
      • modified residue (374)
      • modified residue (383)
      • modified residue (387)
      • modified residue (401)
      • modified residue (413)
      • modified residue (475)
    Domains in SCOPe 2.07: d1m3ed1, d1m3ed2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m3eA (A:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m3eA (A:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeeddnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengil
    glgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskyg
    dlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnr
    iitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvtt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m3eB (B:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m3eB (B:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedgdnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengi
    lglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvsky
    gdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvn
    riitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvtt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m3eC (C:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m3eC (C:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedgdnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengi
    lglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvsky
    gdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvn
    riitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvtt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1m3eD (D:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m3eD (D:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeeddnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengil
    glgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskyg
    dlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnr
    iitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvtt