PDB entry 1m3a

View 1m3a on RCSB PDB site
Description: Solution structure of a circular form of the truncated N-terminal SH3 domain from oncogene protein c-Crk.
Class: protein binding
Keywords: sh3, sh3 domain, circular protein, cyclized protein, adaptor protein
Deposited on 2002-06-27, released 2003-08-05
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-05, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene C-crk
    Species: MUS MUSCULUS
    Gene: CRK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64010 (0-56)
      • engineered (0)
      • engineered (56)
    Domains in SCOP 1.73: d1m3aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3aA (A:)
    cyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyvekyg