PDB entry 1m38

View 1m38 on RCSB PDB site
Description: Structure of Inorganic Pyrophosphatase
Class: hydrolase
Keywords: pyrophosphate phosphohydrolase, hydrolase, cobalt
Deposited on 2002-06-27, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m38a_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m38b_
  • Heterogens: CO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m38A (A:)
    mtyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnaklei
    tkeetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpi
    dvleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfp
    gllratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskg
    idltnvtlpdtptyskaasdaippaspkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m38A (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaspkadapidksidkwffi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m38B (B:)
    mtyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnaklei
    tkeetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpi
    dvleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfp
    gllratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskg
    idltnvtlpdtptyskaasdaippaspkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m38B (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaspkadapidksidkwffi