PDB entry 1m36

View 1m36 on RCSB PDB site
Description: Solution Structure of a CCHC Zinc Finger from MOZ
Class: DNA binding protein
Keywords: zinc finger, acetyl transferase, DNA BINDING PROTEIN
Deposited on 2002-06-27, released 2004-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Monocytic leukemia zinc finger protein
  Species: Homo sapiens [TaxId:9606]
  Gene: MOZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92794 (2-32)
    • cloning artifact (0-1)
  Domains in SCOPe 2.06: d1m36a1, d1m36a2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m36A (A:)
  gsrlpklylcefclkymksrtilqqhmkkcgwf