PDB entry 1m34

View 1m34 on RCSB PDB site
Description: Nitrogenase Complex From Azotobacter Vinelandii Stabilized By ADP-Tetrafluoroaluminate
Class: oxidoreductase
Keywords: nitrogenase, nitrogen fixation, signal transduction, electron transfer, ATP hydrolysis, complex of nitrogenase proteins, oxidoreductase
Deposited on 2002-06-27, released 2003-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34a_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34b_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34c_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34d_
  • Chain 'E':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34e_
  • Chain 'F':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34f_
  • Chain 'G':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34g_
  • Chain 'H':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34h_
  • Chain 'I':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34i_
  • Chain 'J':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34j_
  • Chain 'K':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34k_
  • Chain 'L':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34l_
  • Chain 'M':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34m_
  • Chain 'N':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34n_
  • Chain 'O':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34o_
  • Chain 'P':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m34p_
  • Heterogens: CA, MG, ALF, HCA, CFM, CLF, SF4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m34A (A:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34A (A:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m34B (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m34C (C:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34C (C:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m34D (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1m34E (E:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34E (E:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgim
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1m34F (F:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34F (F:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgim
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1m34G (G:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34G (G:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgim
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1m34H (H:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34H (H:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgim
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1m34I (I:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34I (I:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m34J (J:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1m34K (K:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34K (K:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m34L (L:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1m34M (M:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34M (M:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgim
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1m34N (N:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34N (N:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgim
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1m34O (O:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34O (O:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgim
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1m34P (P:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m34P (P:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgim