PDB entry 1m31

View 1m31 on RCSB PDB site
Description: Three-Dimensional Solution Structure of Apo-Mts1
Class: metal binding protein
Keywords: non-covalent homodimer, x-type four-helix bundle
Deposited on 2002-06-26, released 2002-10-30
The last revision prior to the SCOP 1.73 freeze date was dated 2002-10-30, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Placental calcium-binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1m31a_
  • Chain 'B':
    Compound: Placental calcium-binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1m31b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m31A (A:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m31B (B:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk