PDB entry 1m30

View 1m30 on RCSB PDB site
Description: Solution structure of N-terminal SH3 domain from oncogene protein c-Crk
Class: protein binding
Keywords: sh3, sh3 domain, adaptor protein, protein binding
Deposited on 2002-06-26, released 2003-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proto-oncogene C-crk
  Species: Mus musculus [TaxId:10090]
  Gene: CRK
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q64010 (0-57)
    • engineered (57)
  Domains in SCOPe 2.08: d1m30a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m30A (A:)
  aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyvekyg