PDB entry 1m2y

View 1m2y on RCSB PDB site
Description: Backbone NMR structure of a mutant P. furiosus rubredoxin using residual dipolar couplings
Class: electron transport
Keywords: residual dipolar couplings
Deposited on 2002-06-26, released 2002-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2003-12-23, with a file datestamp of 2007-04-25.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rubredoxin
  Species: Pyrococcus furiosus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24297
    • engineered (3)
    • engineered (23)
    • engineered (32)
  Domains in SCOPe 2.08: d1m2ya_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1m2yA (A:)
  makyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefekled
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1m2yA (A:)
  akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefek