PDB entry 1m2w

View 1m2w on RCSB PDB site
Description: Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and D-mannitol
Class: oxidoreductase
Keywords: Rossmann fold, di-nucleotide binding motif, long-chain dehydrogenase, polyol dehydrogenase, secondary alcohol dehydrogenase, oxidoreductase
Deposited on 2002-06-25, released 2002-11-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannitol dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: mtlD
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08355 (0-End)
      • cloning artifact (0)
      • cloning artifact (49)
      • cloning artifact (104)
      • cloning artifact (145)
      • cloning artifact (186)
      • cloning artifact (227)
      • cloning artifact (234)
      • cloning artifact (293)
      • cloning artifact (321)
      • cloning artifact (330)
      • cloning artifact (334)
    Domains in SCOPe 2.01: d1m2wa3, d1m2wa4
  • Chain 'B':
    Compound: mannitol dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: mtlD
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08355 (0-End)
      • cloning artifact (0)
      • cloning artifact (49)
      • cloning artifact (104)
      • cloning artifact (145)
      • cloning artifact (186)
      • cloning artifact (227)
      • cloning artifact (234)
      • cloning artifact (293)
      • cloning artifact (321)
      • cloning artifact (330)
      • cloning artifact (334)
    Domains in SCOPe 2.01: d1m2wb3, d1m2wb4
  • Heterogens: NAD, MTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m2wA (A:)
    mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
    cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
    speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
    ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
    rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkiglln
    gshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvd
    rfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvden
    gvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdng
    vtttlkhllkkpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m2wA (A:)
    mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
    cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
    speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
    ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
    rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkiglln
    gshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvd
    rfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvden
    gvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdng
    vtttlkhllkkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m2wB (B:)
    mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
    cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
    speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
    ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
    rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkiglln
    gshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvd
    rfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvden
    gvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdng
    vtttlkhllkkpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m2wB (B:)
    mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
    cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
    speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
    ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
    rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkiglln
    gshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvd
    rfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvden
    gvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdng
    vtttlkhllkkp