PDB entry 1m2w

View 1m2w on RCSB PDB site
Description: Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and D-mannitol
Deposited on 2002-06-25, released 2002-11-15
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-15, with a file datestamp of 2002-11-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m2wA (A:)
    mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
    cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
    speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
    ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
    rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkiglln
    gshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvd
    rfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvden
    gvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdng
    vtttlkhllkkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m2wB (B:)
    mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
    cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
    speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
    ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
    rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkiglln
    gshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvd
    rfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvden
    gvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdng
    vtttlkhllkkp