PDB entry 1m2s

View 1m2s on RCSB PDB site
Description: solution structure of a new potassium channels blocker from the venom of chinese scorpion buthus martensi karsch
Deposited on 2002-06-25, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1m2sa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m2sA (A:)
  fglidvkcfassecwtackkvtgsgqgkcqnnqcrcy