PDB entry 1m2m

View 1m2m on RCSB PDB site
Description: Crystal structure of E44A/E48A/E56A/D60A mutant of cytochrome b5
Class: electron transport
Keywords: cytochrome b5, trypsin-cleaved fragment, mutant;a quadruple-site mutant, crystal structure, electron transport
Deposited on 2002-06-24, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (41)
      • engineered (45)
      • engineered (53)
      • engineered (57)
    Domains in SCOPe 2.07: d1m2ma_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m2mA (A:)
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeavlraqaggdatanfeavg
hstdarelsktfiigelhpddr