PDB entry 1m2m

View 1m2m on RCSB PDB site
Description: crystal structure of e44a/e48a/e56a/d60a mutant of cytochrome b5
Deposited on 2002-06-24, released 2003-03-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1m2ma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m2mA (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehpggeavlraqaggdatanfeavg
  hstdarelsktfiigelhpddr