PDB entry 1m1z

View 1m1z on RCSB PDB site
Description: beta-lactam synthetase apo enzyme
Deposited on 2002-06-20, released 2002-10-23
The last revision prior to the SCOP 1.67 freeze date was dated 2002-11-27, with a file datestamp of 2002-11-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m1zA (A:)
    mgapvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdr
    avarsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngr
    fatvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvag
    ltgvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtp
    gdtplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreiti
    pttellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhre
    drlpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhg
    rdkwvlraamadalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvre
    lfdltvgggrhpsevdtddvvrsvadrtargaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1zA (A:)
    apvlpaafgflasartgggpvfatrgshtdidtpqgerslaatlvhapsvapdravarsl
    tgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatvvr
    tgdrvllatdhagsvplytcvapgevrasteakalaahfpladarrvagltgvyqvpaga
    vmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtpgdtplvvlsgg
    idssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpy
    avwasesvdpdiieyllpltalyraldgperriltgygadiplggmhredrlpaldtvla
    hdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhgrdkwvlraama
    dalpaetvnrpkssfsrllldhgvaeakrqvvrelfdltvgggrhpsevdtddvvrsvad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m1zB (B:)
    mgapvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdr
    avarsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngr
    fatvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvag
    ltgvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtp
    gdtplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreiti
    pttellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhre
    drlpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhg
    rdkwvlraamadalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvre
    lfdltvgggrhpsevdtddvvrsvadrtargaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1zB (B:)
    gapvlpaafgflasartggpgpvfatrgshtdidtpqgerslaatlvhapsvapdravar
    sltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatv
    vrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvagltgv
    yqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtpgdtp
    lvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreitiptte
    llaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhlpaldt
    vlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhgrdkwvlra
    amadalpaetvnrttssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtd
    dvvrsvadrt