PDB entry 1m1y

View 1m1y on RCSB PDB site
Description: Chemical Crosslink of Nitrogenase MoFe Protein and Fe Protein
Class: oxidoreductase
Keywords: nitrogenase, nitrogen fixation, chemical crosslink, protein interaction, OXIDOREDUCTASE
Deposited on 2002-06-20, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.279
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1ya_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yb_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yc_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yd_
  • Chain 'E':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1ye_
  • Chain 'F':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yf_
  • Chain 'G':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yg_
  • Chain 'H':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yh_
  • Chain 'I':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yi_
  • Chain 'J':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yj_
  • Chain 'K':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yk_
  • Chain 'L':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yl_
  • Chain 'M':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1ym_
  • Chain 'N':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yn_
  • Chain 'O':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yo_
  • Chain 'P':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1yp_
  • Heterogens: CA, HCA, CFM, CLF, SF4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m1yA (A:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1yA (A:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1yB (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m1yC (C:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1yC (C:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1yD (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1m1yE (E:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1yE (E:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgkta
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1yF (F:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1m1yG (G:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1yG (G:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgkta
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1yH (H:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1m1yI (I:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1yI (I:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1yJ (J:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1m1yK (K:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1yK (K:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1yL (L:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1m1yM (M:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1yM (M:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgkta
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1yN (N:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1m1yO (O:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1yO (O:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgkta
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1yP (P:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev